round grey moon chair with brown pillow on top

POPTÅG

The PopTag is a 76aa C-terminal tag that drives cytoplasmic condensation of chimeric fusion proteins.

This module is originally derived from a bacterial protein and uses an orthogonal molecular grammar that is distinct from natural eukaryote condensates.

PROS:
+ short
+ strong nucleating domain
+ material properties tunable via spacer

CONS:
- only C-terminal fusion
- not inducible

PopTag sequence:

>PopTag
EVAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA*